PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG059990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 227aa    MW: 25684.1 Da    PI: 8.603
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG059990.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-1976130256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC2AG059990.1  76 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRSRQVEVWFQNRRARTK 130
                       788899***********************************************98 PP

2HD-ZIP_I/II125.91.8e-4076165191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+ rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  TRIDC2AG059990.1  76 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRSRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVHELR-AL 165
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    
MMERAEDLGL SLSLSSSLAP RTHHVAMLLH APERRLLEMP LLPAKRVCEV SADEERSGQR  60
GGSDDEDGGC GMDGSRKKLR LSKDQSAVLE DSFREHPTLN PRQKAALAQQ LGLRSRQVEV  120
WFQNRRARTK LKQTEVDCEF LKRCCETLTE ENRRLQKEVH ELRALKLVSP HHYMHMSPPT  180
TLTMCPSCER VSNNNNNNNN NSTAADRRNG VEGAICHRPI AVRPQQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17581SRKKLRL
2125133RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-75HD-ZIP family protein