PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG057970.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 674aa    MW: 72917.7 Da    PI: 5.3459
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG057970.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox474.2e-151441457
                      HHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox 14 eLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      eL++lFe++++p++++r+ L k+++L+ +qVk+WFqNrR++ k+
  TRIDC2AG057970.2  1 ELQALFEQCPHPDEKQRAALGKRVRLQPSQVKFWFQNRRTQLKR 44
                      69**************************************9997 PP

2START164.38.6e-521864162203
                       HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S... CS
             START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetla... 77 
                       la +a++elvk+a+ +ep+W   +        e +n +++l++f+++ +     + +ea+r+sg+v  +   +lve+lld + +W++ +    
  TRIDC2AG057970.2 186 LATSAMDELVKMAQMDEPLWIPNVplpgslakETLNHEVYLRTFSPAIGvkppgFVSEASRESGIVSSDGSvELVETLLDER-RWSRFFScii 277
                       7889*****************999999*******************999****************98775448*********.*******99* PP

                       .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEE CS
             START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepk 157
                        + +t+e is+g      gal lm+a+lq+lsplvp R+++f+R++++lg+g w++vdvS d+  + +      +   +++++lpSg++++++
  TRIDC2AG057970.2 278 aESSTIEEISTGaagsrdGALLLMQAKLQVLSPLVPiREVTFLRFCKKLGEGFWAVVDVSMDELVMEQGlavasTTANMKCRRLPSGCVVQDT 370
                       **************************************************************99988777777788899************** PP

                       CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
             START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                       +ng +kvtwveh+ ++++++h+l+r+l++sgla ga +w+atlqrq
  TRIDC2AG057970.2 371 PNGFCKVTWVEHTVYDESSVHQLYRPLLRSGLALGAGRWLATLQRQ 416
                       ********************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    
ELQALFEQCP HPDEKQRAAL GKRVRLQPSQ VKFWFQNRRT QLKRESLLHE NQQLMAENGK  60
LRAENLSLRV AMAHPVCGGC GGPVPAMLDE SPSLEEEDLR VQNATLKNEL SRLCALASVF  120
LGRSISYVAA PPTPGSPAER IGSVPATTVA NSTVTEFTGS PSSQTAGMAI TAMAKAGIDR  180
SVFLELATSA MDELVKMAQM DEPLWIPNVP LPGSLAKETL NHEVYLRTFS PAIGVKPPGF  240
VSEASRESGI VSSDGSVELV ETLLDERRWS RFFSCIIAES STIEEISTGA AGSRDGALLL  300
MQAKLQVLSP LVPIREVTFL RFCKKLGEGF WAVVDVSMDE LVMEQGLAVA STTANMKCRR  360
LPSGCVVQDT PNGFCKVTWV EHTVYDESSV HQLYRPLLRS GLALGAGRWL ATLQRQYDCL  420
DVLMPKQDSS DAMLEGSRSL LRLAERMMDN FCAGVSASSA EWSKLEDVTG SIGEDVRIMA  480
CRSVDEPGVP AGVVLCAATS VWMLVTPKRL FNFLCNERTR AEWDILSKGG PMQEVTKIYK  540
GQQNGNAVSL LKATAPNTQQ DSSILILQET CTDASSSMVV YTPVDIPAMR RVMGGEGDPA  600
SIMLLPSGFA ILPGGPSISG DDGHKTCGSL LTVAFQILGN RQPTGKLTVE SVQTVDSLIS  660
CTINRIKTAL RCDA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0HD-ZIP family protein