PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG057970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 785aa    MW: 84397.2 Da    PI: 5.8355
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG057970.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.62.7e-15104155657
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       ++t+ q++eL+++ +++++p++++r+ L k+++L+ +qVk+WFqNrR++ k+
  TRIDC2AG057970.1 104 RHTPRQIHELQAYAHQCPHPDEKQRAALGKRVRLQPSQVKFWFQNRRTQLKR 155
                       689*********************************************9997 PP

2START163.91.2e-512975272203
                       HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S... CS
             START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetla... 77 
                       la +a++elvk+a+ +ep+W   +        e +n +++l++f+++ +     + +ea+r+sg+v  +   +lve+lld + +W++ +    
  TRIDC2AG057970.1 297 LATSAMDELVKMAQMDEPLWIPNVplpgslakETLNHEVYLRTFSPAIGvkppgFVSEASRESGIVSSDGSvELVETLLDER-RWSRFFScii 388
                       7889*****************999999*******************999****************98775448*********.*******99* PP

                       .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEE CS
             START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepk 157
                        + +t+e is+g      gal lm+a+lq+lsplvp R+++f+R++++lg+g w++vdvS d+  + +      +   +++++lpSg++++++
  TRIDC2AG057970.1 389 aESSTIEEISTGaagsrdGALLLMQAKLQVLSPLVPiREVTFLRFCKKLGEGFWAVVDVSMDELVMEQGlavasTTANMKCRRLPSGCVVQDT 481
                       **************************************************************99988777777788899************** PP

                       CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
             START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                       +ng +kvtwveh+ ++++++h+l+r+l++sgla ga +w+atlqrq
  TRIDC2AG057970.1 482 PNGFCKVTWVEHTVYDESSVHQLYRPLLRSGLALGAGRWLATLQRQ 527
                       ********************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    
MPREKGMAFW GFFDGDGDDG GPAPGMNEFP YYAAAGPGAL ASSSLSPPSS LAPGRGFVKV  60
EDGSRSMTDH LHAVSGGDAG GGEDGEAAPE LDHRGKRKRP ANARHTPRQI HELQAYAHQC  120
PHPDEKQRAA LGKRVRLQPS QVKFWFQNRR TQLKRESLLH ENQQLMAENG KLRAENLSLR  180
VAMAHPVCGG CGGPVPAMLD ESPSLEEEDL RVQNATLKNE LSRLCALASV FLGRSISYVA  240
APPTPGSPAE RIGSVPATTV ANSTVTEFTG SPSSQTAGMA ITAMAKAGID RSVFLELATS  300
AMDELVKMAQ MDEPLWIPNV PLPGSLAKET LNHEVYLRTF SPAIGVKPPG FVSEASRESG  360
IVSSDGSVEL VETLLDERRW SRFFSCIIAE SSTIEEISTG AAGSRDGALL LMQAKLQVLS  420
PLVPIREVTF LRFCKKLGEG FWAVVDVSMD ELVMEQGLAV ASTTANMKCR RLPSGCVVQD  480
TPNGFCKVTW VEHTVYDESS VHQLYRPLLR SGLALGAGRW LATLQRQYDC LDVLMPKQDS  540
SDAMLEGSRS LLRLAERMMD NFCAGVSASS AEWSKLEDVT GSIGEDVRIM ACRSVDEPGV  600
PAGVVLCAAT SVWMLVTPKR LFNFLCNERT RAEWDILSKG GPMQEVTKIY KGQQNGNAVS  660
LLKATAPNTQ QDSSILILQE TCTDASSSMV VYTPVDIPAM RRVMGGEGDP ASIMLLPSGF  720
AILPGGPSIS GDDGHKTCGS LLTVAFQILG NRQPTGKLTV ESVQTVDSLI SCTINRIKTA  780
LRCDA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0HD-ZIP family protein