PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG055820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 218aa    MW: 24364.4 Da    PI: 9.4732
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG055820.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1862115356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq e Le  F+++r++ + ++  LA++lgL+ +qV vWFqNrRa++k
  TRIDC2AG055820.1  62 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHK 115
                       45689***********************************************99 PP

2HD-ZIP_I/II114.18.4e-3762153293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl++eq+++LE sF+ee+kLe+ rKv la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le+ev +L+e+l++
  TRIDC2AG055820.1  62 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHKSKTLEQEFARLKHAHDAAILHKCHLENEVLRLKEKLRA 153
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    
REARDLSFPS TPCRQWSRCE HWPHGTAQRE SKPKARRRRR RAARCGGGDG NGWEMDGGGD  60
PKKRRLTDEQ AEMLELSFRE ERKLETGRKV YLAAELGLDP KQVAVWFQNR RARHKSKTLE  120
QEFARLKHAH DAAILHKCHL ENEVLRLKEK LRATAEEVQR LRSAAGIHAN GGDSAGAVSV  180
CGGNPGSSFS TGTCQQHPGF SGADVLGRDD DLMMCVPE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13641RRRRRR
23644RRRRRRAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-38HD-ZIP family protein