PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG055810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 193aa    MW: 21427 Da    PI: 10.3824
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG055810.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.6e-1958111356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq e Le  F+++r++ + ++  LA++lgL+ +qV vWFqNrRa++k
  TRIDC2AG055810.1  58 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHK 111
                       45689***********************************************99 PP

2HD-ZIP_I/II113.51.3e-3658149293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl++eq+++LE sF+ee+kLe+ rKv la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le++v +L+e+l++
  TRIDC2AG055810.1  58 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHKSKTLEQEFARLKHAHDAAILHKCHLENQVLRLKEKLRA 149
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    
MDNQQLFGSS YVDTPFFAAN GTAQRESKPK ARRRRRRAAR CGGGDGNGWE MDGGGDPKKR  60
RLTDEQAEML ELSFREERKL ETGRKVYLAA ELGLDPKQVA VWFQNRRARH KSKTLEQEFA  120
RLKHAHDAAI LHKCHLENQV LRLKEKLRAT AEEVQRLRSA AGIHANGGDS AGAVSVCGGN  180
PGSSFSTGTC QQH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13237RRRRRR
23240RRRRRRAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.15e-39HD-ZIP family protein