PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG024080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 237aa    MW: 25730.7 Da    PI: 7.6003
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG024080.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.8e-1959112356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq++ Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  TRIDC2AG024080.1  59 KKRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 112
                       45689***********************************************99 PP

2HD-ZIP_I/II114.18.9e-3759148291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       kkrrl++eqv+ LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k +E+++++Lk+a+da   ++++Le+e  +L+e+l
  TRIDC2AG024080.1  59 KKRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLMEEEFAKLKHAHDAAILHKCHLENELLRLKERL 148
                       9**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    
SMDKQQVFGS SYVDMPFFAA NGTAQGESRP RARRRRRRAA RCGGGDGDGG DMDGGGDPKK  60
RRLTDEQVHG LELSFREERK LETGRKVHLA AELGLDPKQV AVWFQNRRAR HKSKLMEEEF  120
AKLKHAHDAA ILHKCHLENE LLRLKERLGA TEEEVRRLRS AAGSHGASGN GGDAADAVGA  180
CGGSPSSSFS TGTCQQHPGF SGAGQLGPDD ELMMCVPEYG GYADSSVVEW FSLYGLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12938RPRARRRRRR
23338RRRRRR
33341RRRRRRAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-29HD-ZIP family protein