PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG062840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 300aa    MW: 32817.7 Da    PI: 5.9905
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG062840.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-17141195256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Le  F+++++++ e++  LA++l+L  rqV vWFqNrRa+ k
  TRIDC1BG062840.1 141 RKKLRLSKEQSAFLEGSFKEHSTLTLEQKSSLANRLSLRPRQVEVWFQNRRARTK 195
                       678899***********************************************98 PP

2HD-ZIP_I/II117.29.1e-38141229189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rlskeq+++LE sF+e+++L+ e+K++la++L l+prqv+vWFqnrRARtk+kq+E d+e+Lkr+++al++en++L++ev+eLr+
  TRIDC1BG062840.1 141 RKKLRLSKEQSAFLEGSFKEHSTLTLEQKSSLANRLSLRPRQVEVWFQNRRARTKLKQTEADCEQLKRCCEALARENRKLQREVAELRA 229
                       69*************************************************************************************95 PP

Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    
MELELSLGDL PAPVKANNTM LAPATCQGED NDDLALGLRV TATERDDQDN QRTGIETVEG  60
EDSDEACPEL PVRASPFRQA SAQTASANSW GFDVNAAVPV DGRASMARSL SPPSMHMEVP  120
VTQGVDEEAS EDEDNGGGRV RKKLRLSKEQ SAFLEGSFKE HSTLTLEQKS SLANRLSLRP  180
RQVEVWFQNR RARTKLKQTE ADCEQLKRCC EALARENRKL QREVAELRAS RAPYPLYNLN  240
HHMSGFSTAL PVCSSCSTIS AVSSPGSSPM STLFAGRPHF GPFTVTHPVL PLRRQPSATL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145RVRKKLR
2190198RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.19e-48HD-ZIP family protein