PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG038500.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 154aa    MW: 16946.5 Da    PI: 12.1637
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG038500.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.35.2e-1369992656
                      -HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 26 saeereeLAkklgLterqVkvWFqNrRakek 56
                       +++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1BG038500.5 69 HQKQKAALARQLGLRPRQVEVWFQNRRARTK 99
                      67899************************98 PP

2HD-ZIP_I/II1011e-32621341891
       HD-ZIP_I/II  18 FeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       F+ ++ +++++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1BG038500.5  62 FDLRTLMHQKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 134
                       667777899*************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    
AASAARQRGA PAASRSVPAR AATTRTTPGP AAAGRARSSA CPRTSPLSSR TASRSTAPST  60
PFDLRTLMHQ KQKAALARQL GLRPRQVEVW FQNRRARTKL KQTEVDCESL KRCCETLTEE  120
NRRLQREVQE LRALKLLAPP APHLYMRAPP PTTL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194102RRARTKLKQ
2108113ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-32HD-ZIP family protein