PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG038500.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 287aa    MW: 30422.4 Da    PI: 9.1876
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG038500.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-19127181256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1BG038500.4 127 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 181
                       788899***********************************************98 PP

2HD-ZIP_I/II130.28.2e-42127216191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1BG038500.4 127 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 216
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    
HHLGLALGLG LGLSLGMSGT TSPVEPAAPQ TAAAPSSNDR RLAALACHEM PFLRGIDVNR  60
APTTGGARGS CGASEDEEPG ASSPDSTLSS LSGKRGAPTR SAGGEQERTG AGSDDEDDSG  120
AGGGGSRKKL RLSKDQSAVL EDSFKEHSTL NPKQKAALAR QLGLRPRQVE VWFQNRRART  180
KLKQTEVDCE SLKRCCETLT EENRRLQREV QELRALKLLA PPAPHLYMRA PPPTTLTMCP  240
SCERVAPSGK PVVDESRAAM VTRAVPTGPW GPVPVLPVFL GRPAQRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132SRKKLRL
2176184RRARTKLKQ
3190195ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-62HD-ZIP family protein