PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG038500.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 313aa    MW: 33099.3 Da    PI: 9.1808
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG038500.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.4e-19153207256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1BG038500.3 153 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 207
                       788899***********************************************98 PP

2HD-ZIP_I/II1309.7e-42153242191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1BG038500.3 153 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 242
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    
HLGLALGLGL GLSLGMSGTT SPVEPAAPQT AAAPSSKLGL GQQSWNGAGL FFPASSGEQR  60
SHADDRRLAA LACHEMPFLR GIDVNRAPTT GGARGSCGAS EDEEPGASSP DSTLSSLSGK  120
RGAPTRSAGG EQERTGAGSD DEDDSGAGGG GSRKKLRLSK DQSAVLEDSF KEHSTLNPKQ  180
KAALARQLGL RPRQVEVWFQ NRRARTKLKQ TEVDCESLKR CCETLTEENR RLQREVQELR  240
ALKLLAPPAP HLYMRAPPPT TLTMCPSCER VAPSGKPVVD ESRAAMVTRA VPTGPWGPVP  300
VLPVFLGRPA QRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152158SRKKLRL
2202210RRARTKLKQ
3216221ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-62HD-ZIP family protein