PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG038500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 236aa    MW: 25458.6 Da    PI: 8.592
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG038500.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1990144256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1BG038500.1  90 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 144
                       788899***********************************************98 PP

2HD-ZIP_I/II130.85.4e-4290179191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1BG038500.1  90 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 179
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    
DDRRLAALAC HEMPFLRGID VNRAPTTGGA RGSCGASEDE EPGASSPDST LSSLSGKRGA  60
PTRSAGGEQE RTGAGSDDED DSGAGGGGSR KKLRLSKDQS AVLEDSFKEH STLNPKQKAA  120
LARQLGLRPR QVEVWFQNRR ARTKLKQTEV DCESLKRCCE TLTEENRRLQ REVQELRALK  180
LLAPPAPHLY MRAPPPTTLT MCPSCERVAP SGKPVVDESR AAMVTRAVPT GPWGPC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18995SRKKLRL
2139147RRARTKLKQ
3153158ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.14e-63HD-ZIP family protein