PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG034940.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 890aa    MW: 96093.3 Da    PI: 5.952
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG034940.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-20141196156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  TRIDC1BG034940.5 141 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 196
                       688999***********************************************998 PP

2START126.63e-403636072206
                       HHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
             START   2 laeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWdet 75 
                       la +aa+ l+k+   +e++W + +  ++ + ev+  +e ++                    ++e  r+s+vv+m++ +lv  +ld++ +W e 
  TRIDC1BG034940.5 363 LASTAADHLIKMCRTSEQLWARRRgAGPSSGEVMDAEEHARMlswpidsgkqqqadvahaARTEGTRDSAVVIMNSITLVDAFLDQN-KWMEL 454
                       78899999**************9998888888888887777788888888899999999999999**********************.***** PP

                       -S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE.......-TTS--.-TTSEE-EE CS
             START  76 la....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvd.......seqkppesssvvRael 147
                       ++    ka t++vi  g        g l lm+ae+q+lsplvp R++vf Ry+     +g+w ivd   d       ++q+++ +ss+vR+++
  TRIDC1BG034940.5 455 FPsivcKARTIQVIHHGaasghlssGSLILMQAEMQFLSPLVPvREVVFFRYCVHnADEGTWSIVDFPADgfqeellQQQQQQ-TSSLVRCRR 546
                       *******************************************************9999******987653322221333433.9******** PP

                       SSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 148 lpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       +pSg++i++ +ng+s+v+wveh+++ g     + +++  v  g+a+ga +wv+ lqrqce+
  TRIDC1BG034940.5 547 RPSGCIIQDAPNGYSRVVWVEHMEVVGEEKplQPVFKDHVAGGAAFGATRWVSVLQRQCER 607
                       ************************98876549***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 890 aa     Download sequence    
RRTMFGDCQV LSSMAAMAAG GSSADALFAS PLMPNPGALA GFMSNSSAMP FHHHFSTNLI  60
PKEEGVMGGL HMAKDEELDL DMEMELSGGS GSGHLDGLLS FVDVDDDRDQ KPQHSEPDGA  120
GAEHHPSSSA AAAASNGNGK KKRYHRHTAH QIQQMEALFK ECPHPDDKQR LKLSQELGLK  180
PRQVKFWFQN RRTQMKAQQD RADNVILRAE NESLKTDNYR LQAAIRNVVC PSCGHAAVIG  240
DMSYEEQNLR IENARLKDEL DRLACIASRY GGGRQPGMSS ASALSCMSAP PPVLMPPLDL  300
DMNVYSRHFA DCAEQQHGAM DLMALPQQMA SGGHGIAATA SYLQGPMTPV VVQDQDKQLV  360
MELASTAADH LIKMCRTSEQ LWARRRGAGP SSGEVMDAEE HARMLSWPID SGKQQQADVA  420
HAARTEGTRD SAVVIMNSIT LVDAFLDQNK WMELFPSIVC KARTIQVIHH GAASGHLSSG  480
SLILMQAEMQ FLSPLVPVRE VVFFRYCVHN ADEGTWSIVD FPADGFQEEL LQQQQQQTSS  540
LVRCRRRPSG CIIQDAPNGY SRVVWVEHME VVGEEKPLQP VFKDHVAGGA AFGATRWVSV  600
LQRQCERLAS ELARSIADQG VIRTPEARTN MMKLSQRMIT AFCANISASG SQSWTALSDS  660
TEDTVRITTR KNTEPGQPSG VILTAVSTSW LPFSHQQVFE LLADEQQRCQ LEILSTGGSL  720
HEVAHIANGS HPRNCISLLR INSASNSSQN VELLLQESSI HPDGGSLVVF ATVDVDAIQV  780
TMSGEDPSYI PLLPMGFAIF PATSPSPGAT SSDTTSNGET SPGNADEPAA GCLLTVGMQV  840
LASAVPSAKL NLSSVTAINS HICNTIHQIT TALKGAGGGR TEPAPAGSDQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0HD-ZIP family protein