PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG034940.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 831aa    MW: 90012.3 Da    PI: 5.7756
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG034940.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2082137156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  TRIDC1BG034940.4  82 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 137
                       688999***********************************************998 PP

2START126.82.6e-403045482206
                       HHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
             START   2 laeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWdet 75 
                       la +aa+ l+k+   +e++W + +  ++ + ev+  +e ++                    ++e  r+s+vv+m++ +lv  +ld++ +W e 
  TRIDC1BG034940.4 304 LASTAADHLIKMCRTSEQLWARRRgAGPSSGEVMDAEEHARMlswpidsgkqqqadvahaARTEGTRDSAVVIMNSITLVDAFLDQN-KWMEL 395
                       78899999**************9998888888888888777788888888899999999999999**********************.***** PP

                       -S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE.......-TTS--.-TTSEE-EE CS
             START  76 la....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvd.......seqkppesssvvRael 147
                       ++    ka t++vi  g        g l lm+ae+q+lsplvp R++vf Ry+     +g+w ivd   d       ++q+++ +ss+vR+++
  TRIDC1BG034940.4 396 FPsivcKARTIQVIHHGaasghlssGSLILMQAEMQFLSPLVPvREVVFFRYCVHnADEGTWSIVDFPADgfqeellQQQQQQ-TSSLVRCRR 487
                       *******************************************************9999******987653322221333433.9******** PP

                       SSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 148 lpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       +pSg++i++ +ng+s+v+wveh+++ g     + +++  v  g+a+ga +wv+ lqrqce+
  TRIDC1BG034940.4 488 RPSGCIIQDAPNGYSRVVWVEHMEVVGEEKplQPVFKDHVAGGAAFGATRWVSVLQRQCER 548
                       ************************98876549***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    
SQKEEGVMGG LHMAKDEELD LDMEMELSGG SGSGHLDGLL SFVDVDDDRD QKPQHSEPDG  60
AGAEHHPSSS AAAAASNGNG KKKRYHRHTA HQIQQMEALF KECPHPDDKQ RLKLSQELGL  120
KPRQVKFWFQ NRRTQMKAQQ DRADNVILRA ENESLKTDNY RLQAAIRNVV CPSCGHAAVI  180
GDMSYEEQNL RIENARLKDE LDRLACIASR YGGGRQPGMS SASALSCMSA PPPVLMPPLD  240
LDMNVYSRHF ADCAEQQHGA MDLMALPQQM ASGGHGIAAT ASYLQGPMTP VVVQDQDKQL  300
VMELASTAAD HLIKMCRTSE QLWARRRGAG PSSGEVMDAE EHARMLSWPI DSGKQQQADV  360
AHAARTEGTR DSAVVIMNSI TLVDAFLDQN KWMELFPSIV CKARTIQVIH HGAASGHLSS  420
GSLILMQAEM QFLSPLVPVR EVVFFRYCVH NADEGTWSIV DFPADGFQEE LLQQQQQQTS  480
SLVRCRRRPS GCIIQDAPNG YSRVVWVEHM EVVGEEKPLQ PVFKDHVAGG AAFGATRWVS  540
VLQRQCERLA SELARSIADQ GVIRTPEART NMMKLSQRMI TAFCANISAS GSQSWTALSD  600
STEDTVRITT RKNTEPGQPS GVILTAVSTS WLPFSHQQVF ELLADEQQRC QLEILSTGGS  660
LHEVAHIANG SHPRNCISLL RINSASNSSQ NVELLLQESS IHPDGGSLVV FATVDVDAIQ  720
VTMSGEDPSY IPLLPMGFAI FPATSPSPGA TSSDTTSNGE TSPGNADEPA AGCLLTVGMQ  780
VLASAVPSAK LNLSSVTAIN SHICNTIHQI TTALKGAGGG RTEPAPAGSD Q
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0HD-ZIP family protein