PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG034940.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 887aa    MW: 95622.8 Da    PI: 5.8153
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG034940.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-20138193156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  TRIDC1BG034940.3 138 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 193
                       688999***********************************************998 PP

2START125.75.9e-403606042206
                       HHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
             START   2 laeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWdet 75 
                       la +aa+ l+k+   +e++W + +  ++ + ev+  +e ++                    ++e  r+s+vv+m++ +lv  +ld + +W e 
  TRIDC1BG034940.3 360 LASTAADHLIKMCRTSEQLWARRRgAGPSSGEVMDAEEHARMlswpidsgkqqqadvahaARTEGTRDSAVVIMNSITLVDAFLDAN-KWMEL 451
                       78899999**************9998888888888887777788888888899999999999999**********************.***** PP

                       -S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE.......-TTS--.-TTSEE-EE CS
             START  76 la....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvd.......seqkppesssvvRael 147
                       ++    ka t++vi  g        g l lm+ae+q+lsplvp R++vf Ry+     +g+w ivd   d       ++q+++ +ss+vR+++
  TRIDC1BG034940.3 452 FPsivcKARTIQVIHHGaasghlssGSLILMQAEMQFLSPLVPvREVVFFRYCVHnADEGTWSIVDFPADgfqeellQQQQQQ-TSSLVRCRR 543
                       *******************************************************9999******987653322221333433.9******** PP

                       SSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 148 lpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       +pSg++i++ +ng+s+v+wveh+++ g     + +++  v  g+a+ga +wv+ lqrqce+
  TRIDC1BG034940.3 544 RPSGCIIQDAPNGYSRVVWVEHMEVVGEEKplQPVFKDHVAGGAAFGATRWVSVLQRQCER 604
                       ************************98876549***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 887 aa     Download sequence    
MFGDCQVLSS MAAMAAGGSS ADALFASPLM PNPGALAGFM SNSSAMPFHH HFSTNLIPKE  60
EGVMGGLHMA KDEELDLDME MELSGGSGSG HLDGLLSFVD VDDDRDQKPQ HSEPDGAGAE  120
HHPSSSAAAA ASNGNGKKKR YHRHTAHQIQ QMEALFKECP HPDDKQRLKL SQELGLKPRQ  180
VKFWFQNRRT QMKAQQDRAD NVILRAENES LKTDNYRLQA AIRNVVCPSC GHAAVIGDMS  240
YEEQNLRIEN ARLKDELDRL ACIASRYGGG RQPGMSSASA LSCMSAPPPV LMPPLDLDMN  300
VYSRHFADCA EQQHGAMDLM ALPQQMASGG HGIAATASYL QGPMTPVVVQ DQDKQLVMEL  360
ASTAADHLIK MCRTSEQLWA RRRGAGPSSG EVMDAEEHAR MLSWPIDSGK QQQADVAHAA  420
RTEGTRDSAV VIMNSITLVD AFLDANKWME LFPSIVCKAR TIQVIHHGAA SGHLSSGSLI  480
LMQAEMQFLS PLVPVREVVF FRYCVHNADE GTWSIVDFPA DGFQEELLQQ QQQQTSSLVR  540
CRRRPSGCII QDAPNGYSRV VWVEHMEVVG EEKPLQPVFK DHVAGGAAFG ATRWVSVLQR  600
QCERLASELA RSIADQGVIR TPEARTNMMK LSQRMITAFC ANISASGSQS WTALSDSTED  660
TVRITTRKNT EPGQPSGVIL TAVSTSWLPF SHQQVFELLA DEQQRCQLEI LSTGGSLHEV  720
AHIANGSHPR NCISLLRINS ASNSSQNVEL LLQESSIHPD GGSLVVFATV DVDAIQVTMS  780
GEDPSYIPLL PMGFAIFPAT SPSPGATSSD TTSNGETSPG NADEPAAGCL LTVGMQVLAS  840
AVPSAKLNLS SVTAINSHIC NTIHQITTAL KGAGGGRTEP APAGSDQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0HD-ZIP family protein