PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC1BG006760.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 52aa MW: 5679.41 Da PI: 9.8094 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.5 | 1.3e-07 | 16 | 47 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+ Ed +lv v++lG ++W+ a+ g TRIDC1BG006760.1 16 KGPWTENEDAQLVWFVRLLGERRWDFLAQVSG 47 79***********************9999887 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 52 aa Download sequence |
MCNNSGGRGG AMAARKGPWT ENEDAQLVWF VRLLGERRWD FLAQVSGLRG GG |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46130.1 | 5e-10 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC1BG006760.1 |