PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG054870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 332aa    MW: 36449.1 Da    PI: 6.9148
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG054870.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.12.7e-17168222256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Le  F+++++++ e++  LA++l+L  rqV vWFqNrRa+ k
  TRIDC1AG054870.1 168 RKKLRLSKEQSAFLEGSFKEHSTLTLEQKSCLANRLSLRPRQVEVWFQNRRARTK 222
                       678899***********************************************98 PP

2HD-ZIP_I/II1162.3e-37168256189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rlskeq+++LE sF+e+++L+ e+K+ la++L l+prqv+vWFqnrRARtk+kq+E d+e+Lkr+++al++en++L++ev+eLr+
  TRIDC1AG054870.1 168 RKKLRLSKEQSAFLEGSFKEHSTLTLEQKSCLANRLSLRPRQVEVWFQNRRARTKLKQTEADCERLKRCCEALARENRKLQREVAELRA 256
                       69*************************************************************************************95 PP

Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    
ADHFYICGTC YLFPLRLITP RPLPFLDMEL ELSLGDLPAP VKASTMPAPA TCQGEDHDDL  60
ALGLRVTATQ RADQDNQRIS IETAEGEEDS DEACRELPVR ASPFRQASSQ TASANSRGFD  120
VNAAVPVDGR ASIVRSLSPP SMHMEVPVTQ GVDEEASEDE DNGGGRVRKK LRLSKEQSAF  180
LEGSFKEHST LTLEQKSCLA NRLSLRPRQV EVWFQNRRAR TKLKQTEADC ERLKRCCEAL  240
ARENRKLQRE VAELRASRAP YPLYNLNHHL SGFSTVLPAG SSCDATTRST VSAVSSPGPS  300
PVSTLFPGRP HFGPFTVSHP VLPLCRQPSA TL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166172RVRKKLR
2217225RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-47HD-ZIP family protein