PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG033140.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 288aa    MW: 30396.4 Da    PI: 9.4851
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG033140.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-19128182256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1AG033140.4 128 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 182
                       788899***********************************************98 PP

2HD-ZIP_I/II130.28.2e-42128217191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1AG033140.4 128 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 217
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    
HLGLGLGLGL SLGMSGTTSP VEPAAPQRAL TAAAPSTLGR QQLAALACHE MPSLRGIDVN  60
RAPATGGARG SCGASEDEEP GASSPDSTLS SLSGKRGAPT RSGGGEQERA GAGSDDEDDS  120
GTGGAGSRKK LRLSKDQSAV LEDSFKEHST LNPKQKAALA RQLGLRPRQV EVWFQNRRAR  180
TKLKQTEVDC ESLKRCCETL TEENRRLQRE VQELRALKLL APPAPHLYMR APPPTTLTMC  240
PSCERVAPSG KPAVDESRAA MVTRAVPTGP WGPVPVMPVF LGRPAQRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127133SRKKLRL
2177185RRARTKLKQ
3191196ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.17e-61HD-ZIP family protein