PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG033140.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 314aa    MW: 33259.4 Da    PI: 9.4302
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG033140.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.4e-19154208256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1AG033140.3 154 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 208
                       788899***********************************************98 PP

2HD-ZIP_I/II1309.7e-42154243191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1AG033140.3 154 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 243
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    
LGLGLGLGLS LGMSGTTSPV EPAAPQRALT AAAPSTLGRQ QQQSWNGAGL FYPASSGEQP  60
RSHADDRRLA ALACHEMPSL RGIDVNRAPA TGGARGSCGA SEDEEPGASS PDSTLSSLSG  120
KRGAPTRSGG GEQERAGAGS DDEDDSGTGG AGSRKKLRLS KDQSAVLEDS FKEHSTLNPK  180
QKAALARQLG LRPRQVEVWF QNRRARTKLK QTEVDCESLK RCCETLTEEN RRLQREVQEL  240
RALKLLAPPA PHLYMRAPPP TTLTMCPSCE RVAPSGKPAV DESRAAMVTR AVPTGPWGPV  300
PVMPVFLGRP AQRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153159SRKKLRL
2203211RRARTKLKQ
3217222ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-60HD-ZIP family protein