PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG033140.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 249aa    MW: 27036.5 Da    PI: 8.2827
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG033140.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-1981135256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC1AG033140.2  81 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 135
                       788899***********************************************98 PP

2HD-ZIP_I/II130.66.1e-4281170191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++ev+eLr +l
  TRIDC1AG033140.2  81 RKKLRLSKDQSAVLEDSFKEHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCESLKRCCETLTEENRRLQREVQELR-AL 170
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    
CHEMPSLRGI DVNRAPATGG ARGSCGASED EEPGASSPDS TLSSLSGKRG APTRSGGGEQ  60
ERAGAGSDDE DDSGTGGAGS RKKLRLSKDQ SAVLEDSFKE HSTLNPKQKA ALARQLGLRP  120
RQVEVWFQNR RARTKLKQTE VDCESLKRCC ETLTEENRRL QREVQELRAL KLLAPPAPHL  180
YMRAPPPTTL TMCPSCERVA PSGKPAVDES RAAMVTRAVP TGPWGPVPVM PVFLGSWELT  240
IQWPYLMEY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18086SRKKLRL
2130138RRARTKLKQ
3144149ESLKRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-61HD-ZIP family protein