PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG029320.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 886aa    MW: 95574.7 Da    PI: 6.0761
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG029320.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.3e-20141196156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  TRIDC1AG029320.6 141 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 196
                       688999***********************************************998 PP

2START126.53.2e-403596031206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
             START   1 elaeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWde 74 
                       ela +aa+ l+k+   +ep+W + + +++ + ev+  +e ++                    ++e  r+s+vv+m++ +lv  +ld + +W e
  TRIDC1AG029320.6 359 ELASTAADHLIKMCRTSEPLWARRRgTGPSSGEVMDAEEHARMlswpidsgkqqqsdvahsARTEGTRDSAVVIMNSITLVDAFLDAN-KWME 450
                       578999********************9999999999998888899999999999****99999*************************.**** PP

                       T-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--......-TTSEE-EES CS
             START  75 tla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.....sssvvRaell 148
                        ++    ka t++vi  g        g l lm+ae+q+lsplvp R++vf Ry+     +g+w ivd   d  q+        +ss+vR++++
  TRIDC1AG029320.6 451 LFPsivcKARTIQVIHHGaasghlssGSLILMQAEMQFLSPLVPaREVVFFRYCVHnADEGTWSIVDFPADGFQEELLqqqqqTSSLVRCRRR 543
                       ********************************************************9999*******88775444322333459********* PP

                       SEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 149 pSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       pSg++i++ +ng+s+v wveh+++ g     + +++  v  g+a+ga +wv+ lqrqce+
  TRIDC1AG029320.6 544 PSGCIIQDAPNGYSRVLWVEHMEVVGEEKplQPVFKDHVAGGAAFGATRWVSVLQRQCER 603
                       ***********************98876549***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 886 aa     Download sequence    
RRTMFGDCQV LSSMAAMAAG GSSADALFAS PLMPNPGALA GFMSNSSAMP FHHHFSTNLI  60
PKEEGVMGGL HLAKDEELDL DMEMELSGGS GSGHLDGLLS FADVDDDRDQ KPQHSEPDGA  120
GAGHHPSSSA AAAASNGNGK KKRYHRHTAH QIQQMEALFK ECPHPDDKQR LKLSQELGLK  180
PRQVKFWFQN RRTQMKAQQD RADNVILRAE NESLKTDNYR LQAAIRNVVC PSCGHAAVIG  240
DMSYEEQNLR IENARLKDEL DRLACIASRY GGGRQPGMSS ASALSCMSAP PPVLMPPLDL  300
DMNVYSRHFA EQQHGAMDLM ALPQQMAAGG HGIAATASYL QGPMTPVIVQ EQDKQLVMEL  360
ASTAADHLIK MCRTSEPLWA RRRGTGPSSG EVMDAEEHAR MLSWPIDSGK QQQSDVAHSA  420
RTEGTRDSAV VIMNSITLVD AFLDANKWME LFPSIVCKAR TIQVIHHGAA SGHLSSGSLI  480
LMQAEMQFLS PLVPAREVVF FRYCVHNADE GTWSIVDFPA DGFQEELLQQ QQQTSSLVRC  540
RRRPSGCIIQ DAPNGYSRVL WVEHMEVVGE EKPLQPVFKD HVAGGAAFGA TRWVSVLQRQ  600
CERLASELAR SIADQGVIRT PEARTNMMKL SQRMVTAFCA NISASGSQSW TALSDSTEDT  660
VRITTRKNTE PGQPSGVILT AVSTSWLPFS HQQVFELLAD EQQRCQLEIL SNGGSLHEVA  720
HIANGSHPRN CISLLRINSA SNSSQNVELL LQESSIHPDG GSLVVFATVD VDAIQVTMSG  780
EDPSYIPLLP MGFAIFPATS PSPGATSSDT TSNGESSPGN ADEPATGCLL TVGMQVLASA  840
VPSAKLNLSS VTAINSHICN TIHQITTALK GAGGSRTEPA PAGSDQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0HD-ZIP family protein