PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG029320.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 827aa    MW: 89553.8 Da    PI: 5.9255
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG029320.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2082137156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  TRIDC1AG029320.5  82 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 137
                       688999***********************************************998 PP

2START126.72.8e-403005441206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
             START   1 elaeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWde 74 
                       ela +aa+ l+k+   +ep+W + + +++ + ev+  +e ++                    ++e  r+s+vv+m++ +lv  +ld + +W e
  TRIDC1AG029320.5 300 ELASTAADHLIKMCRTSEPLWARRRgTGPSSGEVMDAEEHARMlswpidsgkqqqsdvahsARTEGTRDSAVVIMNSITLVDAFLDAN-KWME 391
                       578999********************9999999999998888899999999999****99999*************************.**** PP

                       T-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--......-TTSEE-EES CS
             START  75 tla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.....sssvvRaell 148
                        ++    ka t++vi  g        g l lm+ae+q+lsplvp R++vf Ry+     +g+w ivd   d  q+        +ss+vR++++
  TRIDC1AG029320.5 392 LFPsivcKARTIQVIHHGaasghlssGSLILMQAEMQFLSPLVPaREVVFFRYCVHnADEGTWSIVDFPADGFQEELLqqqqqTSSLVRCRRR 484
                       ********************************************************9999*******88775444322333459********* PP

                       SEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 149 pSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       pSg++i++ +ng+s+v wveh+++ g     + +++  v  g+a+ga +wv+ lqrqce+
  TRIDC1AG029320.5 485 PSGCIIQDAPNGYSRVLWVEHMEVVGEEKplQPVFKDHVAGGAAFGATRWVSVLQRQCER 544
                       ***********************98876549***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    
FQKEEGVMGG LHLAKDEELD LDMEMELSGG SGSGHLDGLL SFADVDDDRD QKPQHSEPDG  60
AGAGHHPSSS AAAAASNGNG KKKRYHRHTA HQIQQMEALF KECPHPDDKQ RLKLSQELGL  120
KPRQVKFWFQ NRRTQMKAQQ DRADNVILRA ENESLKTDNY RLQAAIRNVV CPSCGHAAVI  180
GDMSYEEQNL RIENARLKDE LDRLACIASR YGGGRQPGMS SASALSCMSA PPPVLMPPLD  240
LDMNVYSRHF AEQQHGAMDL MALPQQMAAG GHGIAATASY LQGPMTPVIV QEQDKQLVME  300
LASTAADHLI KMCRTSEPLW ARRRGTGPSS GEVMDAEEHA RMLSWPIDSG KQQQSDVAHS  360
ARTEGTRDSA VVIMNSITLV DAFLDANKWM ELFPSIVCKA RTIQVIHHGA ASGHLSSGSL  420
ILMQAEMQFL SPLVPAREVV FFRYCVHNAD EGTWSIVDFP ADGFQEELLQ QQQQTSSLVR  480
CRRRPSGCII QDAPNGYSRV LWVEHMEVVG EEKPLQPVFK DHVAGGAAFG ATRWVSVLQR  540
QCERLASELA RSIADQGVIR TPEARTNMMK LSQRMVTAFC ANISASGSQS WTALSDSTED  600
TVRITTRKNT EPGQPSGVIL TAVSTSWLPF SHQQVFELLA DEQQRCQLEI LSNGGSLHEV  660
AHIANGSHPR NCISLLRINS ASNSSQNVEL LLQESSIHPD GGSLVVFATV DVDAIQVTMS  720
GEDPSYIPLL PMGFAIFPAT SPSPGATSSD TTSNGESSPG NADEPATGCL LTVGMQVLAS  780
AVPSAKLNLS SVTAINSHIC NTIHQITTAL KGAGGSRTEP APAGSDQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0HD-ZIP family protein