PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG029320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 734aa    MW: 80630.3 Da    PI: 6.4777
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG029320.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651.1e-20138193156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  TRIDC1AG029320.1 138 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 193
                       688999***********************************************998 PP

2START128.77.2e-413566001206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
             START   1 elaeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWde 74 
                       ela +aa+ l+k+   +ep+W + + +++ + ev+  +e ++                    ++e  r+s+vv+m++ +lv  +ld + +W e
  TRIDC1AG029320.1 356 ELASTAADHLIKMCRTSEPLWARRRgTGPSSGEVMDAEEHARMlswpidsgkqqqsdvahsARTEGTRDSAVVIMNSITLVDAFLDAN-KWME 447
                       578999********************9999999999998888899999999999****99999*************************.**** PP

                       T-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--......-TTSEE-EES CS
             START  75 tla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.....sssvvRaell 148
                        ++    ka t++vi  g        g l lm+ae+q+lsplvp R++vf Ry+     +g+w ivd   d  q+        +ss+vR++++
  TRIDC1AG029320.1 448 LFPsivcKARTIQVIHHGaasghlssGSLILMQAEMQFLSPLVPaREVVFFRYCVHnADEGTWSIVDFPADGFQEELLqqqqqTSSLVRCRRR 540
                       ********************************************************9999*******88775444322333459********* PP

                       SEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 149 pSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       pSg++i++ +ng+s+v+wveh+++ g     + +++  v  g+a+ga +wv+ lqrqce+
  TRIDC1AG029320.1 541 PSGCIIQDAPNGYSRVVWVEHMEVVGEEKplQPVFKDHVAGGAAFGATRWVSVLQRQCER 600
                       ***********************98876549***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    
MFGDCQVLSS MAAMAAGGSS ADALFASPLM PNPGALAGFM SNSSAMPFHH HFSTNLIPKE  60
EGVMGGLHLA KDEELDLDME MELSGGSGSG HLDGLLSFAD VDDDRDQKPQ HSEPDGAGAG  120
HHPSSSAAAA ASNGNGKKKR YHRHTAHQIQ QMEALFKECP HPDDKQRLKL SQELGLKPRQ  180
VKFWFQNRRT QMKAQQDRAD NVILRAENES LKTDNYRLQA AIRNVVCPSC GHAAVIGDMS  240
YEEQNLRIEN ARLKDELDRL ACIASRYGGG RQPGMSSASA LSCMSAPPPV LMPPLDLDMN  300
VYSRHFAEQQ HGAMDLMALP QQMAAGGHGI AATASYLQGP MTPVIVQEQD KQLVMELAST  360
AADHLIKMCR TSEPLWARRR GTGPSSGEVM DAEEHARMLS WPIDSGKQQQ SDVAHSARTE  420
GTRDSAVVIM NSITLVDAFL DANKWMELFP SIVCKARTIQ VIHHGAASGH LSSGSLILMQ  480
AEMQFLSPLV PAREVVFFRY CVHNADEGTW SIVDFPADGF QEELLQQQQQ TSSLVRCRRR  540
PSGCIIQDAP NGYSRVVWVE HMEVVGEEKP LQPVFKDHVA GGAAFGATRW VSVLQRQCER  600
LASELARSIA DQGVIRTPEA RTNMMKLSQR MVTAFCANIS ASGSQSWTAL SDSTEDTVRI  660
TTRKNTEPGQ PSGVILTAVS TSWLPFSHQQ VFELLADEQQ RCQSLRFCQT GAHFMRWHIL  720
QMDHTQGIAF LFFA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0HD-ZIP family protein