PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro07_G33926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 184aa    MW: 20157 Da    PI: 7.6328
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro07_G33926genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.31.5e-2051108158
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredam 58 
                  +CaaCk+lrr+C++ Cvlapyfp ++p kf ++h++FGasn++k+l++   e +++++
  Ro07_G33926  51 PCAACKTLRRRCVERCVLAPYFPPSEPLKFTIAHRVFGASNIIKFLQKQISELQSQLA 108
                  7**********************************************97666665554 PP

Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    
MEFNGSTTTT TTTPPSSLSY SPLISSSSSS PATSPTTSAL PPLPPAVVVS PCAACKTLRR  60
RCVERCVLAP YFPPSEPLKF TIAHRVFGAS NIIKFLQKQI SELQSQLAKA QAELFNMQCQ  120
QGNLIALICM NMRSSSAPNT TQQSKEAVAP ILQQQQYLNY NIDTSCFLDE NCLGTVWDWE  180
SLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-36LBD family protein