PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro07_G27174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 266aa    MW: 29136.1 Da    PI: 7.0979
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro07_G27174genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77.2e-42971961100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C++ Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da++s+vyeA+ar+rdPvyG++g i +lq+q+++l+++la+++
  Ro07_G27174  97 PCAACKTLRRRCVERCVLAPYFPPSEPLKFTIAHRVFGASNIIKFLQDLPESQRADAVNSMVYEANARLRDPVYGCAGAICSLQKQISELQSQLAKAQ 194
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Ro07_G27174 195 AE 196
                  87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    
FETTPSSVQT RDLSIYRFIL ITSFSILTRA TQLNSSILRT QTMEFNGSTT TTTTTTTTPP  60
SSLSYSPLIS SSSSSSPATS PTTSAPPSLP PAVVVSPCAA CKTLRRRCVE RCVLAPYFPP  120
SEPLKFTIAH RVFGASNIIK FLQDLPESQR ADAVNSMVYE ANARLRDPVY GCAGAICSLQ  180
KQISELQSQL AKAQAELLNM QCQQGNLIAL ICMEMRSAAP NTTQQSKEAV APILQQQQHL  240
NYNIDTSCFL DENYLSTVCD WESLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-70LBD family protein