PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro07_G18653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 146aa    MW: 16409.5 Da    PI: 6.222
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro07_G18653genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.72.6e-4051041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaC++lrr+C++dC+++pyfp ++p++fa vh+++Gasnv ++l++lp++ r +a+++l+yeAe+r++dPvyG+vgvi++l++q+++++ ela+++
  Ro07_G18653   5 RCAACRYLRRRCPSDCIFSPYFPPNNPQRFASVHRIYGASNVGRMLQQLPPHLRAEAADALYYEAECRVEDPVYGCVGVISRLHEQIHEAECELAKTR 102
                  6**********************************************************************************************998 PP

       DUF260  99 ee 100
                  + 
  Ro07_G18653 103 AD 104
                  75 PP

Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    
MISGRCAACR YLRRRCPSDC IFSPYFPPNN PQRFASVHRI YGASNVGRML QQLPPHLRAE  60
AADALYYEAE CRVEDPVYGC VGVISRLHEQ IHEAECELAK TRADIMINSD IGQQAQVQHI  120
NGEVEDNLSL LHEQSNVGQT QFGSSF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.17e-37LBD family protein