PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro07_G04761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 213aa    MW: 23430.9 Da    PI: 6.8412
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro07_G04761genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.88.8e-44411401100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+Ca+dC++ap fp+++p+kfa+vhk+FGasnv+k+l++lp ++r+da+sslvyeA+ar+rdPvyG+vg i++lq+q+++l+ +la+++
  Ro07_G04761  41 PCASCKLLRRRCAHDCIFAPFFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRTDAVSSLVYEANARVRDPVYGCVGAISSLQKQVSELQMQLAVAQ 138
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Ro07_G04761 139 AE 140
                  87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    
SIFSNLFTCF QSHILNCYSP LLSTALQTFL GSKMGGNGTS PCASCKLLRR RCAHDCIFAP  60
FFPSDDPHKF AIVHKVFGAS NVSKMLQELP VHQRTDAVSS LVYEANARVR DPVYGCVGAI  120
SSLQKQVSEL QMQLAVAQAE ILCIQAQQEP MVLPTQQIDT CTNDEKSYVL HYNLPQYLNF  180
PSSSSGYVIP DSLKMEGIFG HDMIFSASSI VPV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-76LBD family protein