PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro07_G04723
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 266aa    MW: 29117.9 Da    PI: 7.3742
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro07_G04723genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.96.3e-42521511100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+a+l++++
  Ro07_G04723  52 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQADLNAVR 149
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                   e
  Ro07_G04723 150 GE 151
                  76 PP

Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    
MSRERERFDF DEIGKKLKRE IDASNSSSSY HHHQMGRRHM LGPPGTLNTI TPCAACKLLR  60
RRCAQECPFS PYFSPHEPQK FASVHKVFGA SNVSKMLMEV PESQRADAAN SLVYEANVRL  120
RDPVYGCMGA ISALQQQVQS LQADLNAVRG EILKYKYREA NLMDPSSHHH HQVASLFSTP  180
SGGAVSVASL PPTTQQPPPP PPPPPLPPTS SSSSMYTQPN SAADYSTLSS ENVSYFVLLF  240
HAITEADLSV AMLVIDHELM PAGSGS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-84LBD family protein