PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro06_G16349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 305aa    MW: 34107.1 Da    PI: 5.9781
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro06_G16349genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.84.9e-40101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rr+C kdC lap+fpa+qpk f+n+h+l+G+sn++k+lk++++e++e+am+s++ye+++ra+ Pv G++g+i++l+ ql+q+ +el +++
  Ro06_G16349  10 ACAACKYQRRRCIKDCDLAPHFPADQPKMFQNAHRLYGVSNIMKILKQTHPEQKEEAMRSIIYESNMRAKFPVTGCMGIINQLTFQLQQALEELRYVR 107
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  ++
  Ro06_G16349 108 TH 109
                  76 PP

Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    
MTIKGGTSQA CAACKYQRRR CIKDCDLAPH FPADQPKMFQ NAHRLYGVSN IMKILKQTHP  60
EQKEEAMRSI IYESNMRAKF PVTGCMGIIN QLTFQLQQAL EELRYVRTHL AICRDQCQYQ  120
YNSPSCPSSQ LQLGIQTNDH EALQLYQQQY QYHQYNSAAG SSAGGGGMSL MANEYLANGI  180
NGVYIDENDS VVKPLRVQQF YYGNNNVDAA VAAQHNLMTS QGFPIQQEMD VPHDYDDIPF  240
DTIADDRQSY IESKEACESS AESAFKGTTT QSIEHVSQND LKSAAACFTN RVGHGTTSFA  300
MSTVE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-43LBD family protein