PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro06_G09266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 252aa    MW: 27335.5 Da    PI: 8.1475
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro06_G09266genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.51.6e-4591081100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l  +k
  Ro06_G09266   9 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLTCAK 106
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  Ro06_G09266 107 SE 108
                  76 PP

Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    
MASSSSNSPC AACKFLRRKC QPECVFAPYF PPDQPQKFAN VHKVFGASNV TKLLNELHPH  60
QREDAVNSLA YEADMRLRDP VYGCVGVISL LQHQLRQLQM DLTCAKSELS KYQNLQGIAS  120
HGLIAAAAAA AAATATNHHS NNILNNQYNF LSSSRERERE INLISSATTG IGIGTGGVGG  180
GRGSADQYNS ISHHQFFPRD QQQQMIRTFD QAASGNINYD ASSLLAMNVS AGIPFQQPRA  240
AAGDDRRTID PS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.35e-76LBD family protein