PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro06_G09110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 317aa    MW: 35208.3 Da    PI: 6.2442
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro06_G09110genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.84.2e-39361351100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am+++++++++ra+dPv G++++i++lq+ ++  kael+ + 
  Ro06_G09110  36 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKHLDHRDKDEAMRTIIFQSDVRASDPVGGCYRIIQELQRLIDYNKAELDIVL 133
                  7*********************************************************************************************9887 PP

       DUF260  99 ee 100
                  ++
  Ro06_G09110 134 HQ 135
                  76 PP

Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    
MSMSSGSLVT TTSTPSSSVP TTSSSSSTKG NGNTQACAAC KYQRRKCAPD CILAPYFPHD  60
RQRQFLNAHK LFGVSNITKI IKHLDHRDKD EAMRTIIFQS DVRASDPVGG CYRIIQELQR  120
LIDYNKAELD IVLHQLALCR AHAQQHTMVP QVGDNPCADQ MIGVDPLSLY ANPIAHFHYQ  180
MAGQQQDQGA PYVFVQNTNG NNGHQHLGPE DVNMWAMQDS MSSLHIKHGM NASDCEDIKP  240
FVDIPCDDDH HRNHEINFQP ADPIAQHSDE ALLKIDNGNL KEDQQSESAA QQVHHHQELG  300
DLKGEATLFM TLTNCTS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-57LBD family protein