PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro06_G03936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 178aa    MW: 19758.5 Da    PI: 8.2083
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro06_G03936genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.62.5e-4428126199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC +dCv+apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el++++
  Ro06_G03936  28 PCAACKFLRRKCMPDCVFAPYFPPEEPHKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELDATN 125
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  Ro06_G03936 126 A 126
                  6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    
MDIILINLLQ IVCMASSSSY SSSSCNSPCA ACKFLRRKCM PDCVFAPYFP PEEPHKFANV  60
HKIFGASNVS KLLNEVLPHQ REDAVNSLAY EAEARMKDPV YGCVGAISVL QRQVIRLQKE  120
LDATNADLLR YAGDSCNRGT GRGPHHVGQN SGLYNFSSPY DPYGDHRNQM RNLAKIFA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-63LBD family protein