PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro03_G06934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 186aa    MW: 20795.6 Da    PI: 7.9669
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro03_G06934genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.11e-45141131100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la ++
  Ro03_G06934  14 PCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLAIAQ 111
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  +e
  Ro03_G06934 112 AE 113
                  76 PP

Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    
MKEISGRKQG GMSPCAACKL LRRRCAQDCV FAPYFPADEP HKFASVHKVF GASNVNKMLQ  60
ELPEHQRSDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI DVLQTQLAIA QAEVVHLKMG  120
QFPSTSSPAT TPETTSPISV KHTMPNNNNN SQQQLQHRHH YHPHHQTTKS FFTMDMVEDL  180
ILLENL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-67LBD family protein