PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0009785.1_g000021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 392aa    MW: 42843.5 Da    PI: 7.3861
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0009785.1_g000021.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.5e-31142197359
                ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                +++YkeClkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC+CHRnFHR+e e 
  Rmu_sc0009785.1_g000021.1 142 SIKYKECLKNHAAAMGGTATDGCGEFMPS-GEEGTIEALTCSACNCHRNFHRKEIEG 197
                                689*************************9.999********************9875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    
MELSSHQEGQ IPISIPIPIP IPINSSYGAG GHGHGHGHMI HHHHHHPPAA PHTHTLTHNN  60
HLITSSAAAV VAPPPPPPQN QIPASINNNG SSIPKTASLD QEEEEEEEED EEHVNHVNVA  120
YNNNNNNNNS GSNNNKKVVN SSIKYKECLK NHAAAMGGTA TDGCGEFMPS GEEGTIEALT  180
CSACNCHRNF HRKEIEGDHG MSSWDLNSNT RVGTGGRKVL LGHPNGHKNI SILAPDALGF  240
HTAANPTGGF LPSRTAPHHP HHHPHPHHMI MSYNNNMAIG GLMGSQLPSE SDEQEQDQIH  300
HHGHGGGVNV ASRAPVQLVK KRFRTKFTQE QKEKMFNFAE KVGWKIQKQE ESVVQNFCHE  360
IGVKRRVLKV WMHNNKHNLA KNKSQPSPST AA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.12e-63ZF-HD family protein