PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0007826.1_g000021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 257aa    MW: 27713.8 Da    PI: 7.1938
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0007826.1_g000021.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.72.1e-3160114358
                ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                ++rY+eC+kNhA+++Ggha+DGC+Ef+++ geegt +alkCaAC+CHRnFHR+e++
  Rmu_sc0007826.1_g000021.1  60 TIRYRECQKNHAVNIGGHALDGCCEFLAA-GEEGTLDALKCAACNCHRNFHRKEPA 114
                                78**************************9.999********************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    
MEFNDQHEEQ DEEMEMSPTA PTPPRYDASM PKMGPSSGGG GGGGEDTARK RGPSISTVST  60
IRYRECQKNH AVNIGGHALD GCCEFLAAGE EGTLDALKCA ACNCHRNFHR KEPAEGGGGA  120
ILPHQHTQQP FSAYYRHPYP PTPSGYLHLT PAQPHGPLAL PAAGSGGSHS REEGDDVSNP  180
SSSGGGGSGV GLLKKRFRTK FTAEQKEKMV EFAEKVGWRI QKHDEAAVEE FCADTGVKRQ  240
VLKVWMHNNK HTIGKKP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-70ZF-HD family protein