PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0007066.1_g000005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 86aa    MW: 9452.56 Da    PI: 7.739
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0007066.1_g000005.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.35.9e-312074359
                ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                               +vrY eC+kNhAa +Gg+avDGC+Efm+s geeg +aal+CaACgCHRnFHRreve+
  Rmu_sc0007066.1_g000005.1 20 NVRYVECQKNHAAGVGGYAVDGCREFMAS-GEEG-TAALTCAACGCHRNFHRREVET 74
                               79**************************9.6664.689****************875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    
MRKRQVVVRR EEPSSNTIRN VRYVECQKNH AAGVGGYAVD GCREFMASGE EGTAALTCAA  60
CGCHRNFHRR EVETVCECSS PTSTEA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-26ZF-HD family protein