PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0006214.1_g000016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 206aa    MW: 22443.9 Da    PI: 8.3016
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0006214.1_g000016.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.53.8e-29960457
                ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                                +Y+eCl+NhAaslG++a+DGCgEf+ +  +++++ +l+CaACgCHRnFHRr +
  Rmu_sc0006214.1_g000016.1  9 DVYRECLRNHAASLGSYATDGCGEFTLD--DTSSPGGLQCAACGCHRNFHRRVT 60
                               58*************************8..5578******************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    
MEGENSSNDV YRECLRNHAA SLGSYATDGC GEFTLDDTSS PGGLQCAACG CHRNFHRRVT  60
YAPGLGRSSG GGTAHHRVIS CSSRGDLHHE MMTSQELIDY NVGGGGGAAA RQMMVVESPD  120
SGDRSGSGRK RFRSKFTVEQ KEKMLAFAEK LGWKLQRKDL EDEIERFCRS IGVSRQVFKV  180
WMHNHKNLSS SSSASTTANA SSLTTQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-34ZF-HD family protein