PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0006128.1_g000009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 351aa    MW: 38823.4 Da    PI: 8.8581
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0006128.1_g000009.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.61.1e-31132189260
                ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                ++vrY+eClkNhAas+Gg+++DGCgEfmps gee ++ +lkCaAC+CHR+FHR+e e e
  Rmu_sc0006128.1_g000009.1 132 KAVRYRECLKNHAASTGGYVLDGCGEFMPS-GEEDSPGGLKCAACECHRSFHRKEIEGE 189
                                579**************************9.8888********************9875 PP

2Homeobox16.41.6e-05288348157
                                TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                   Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                +r Rt+f++eq + + e+ e    + ++ +++e ++L ++lg+  ++ kvW +N ++ +kk
  Rmu_sc0006128.1_g000009.1 288 KRFRTKFSQEQKDKMMEVAEklgwRIQKHDEQEVQQLCSELGIRRQVFKVWMHNNKQAMKK 348
                                789************99999676668999****************************9997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    
MEVRGQDKVL GMPTTLGFNP QHRDSSSSKL SSPSLHHHVN NTLIFNHPQT LDPFYQAPPH  60
HHHHHQPQQS NPYKPSRDPD PIPIPNPDPN LSPAAVCTSP RATSGTPIAS RANHSFKAAP  120
SALAPEPITA SKAVRYRECL KNHAASTGGY VLDGCGEFMP SGEEDSPGGL KCAACECHRS  180
FHRKEIEGET QLVHVPNNYH VLNHHNKNSH SSRNASSAPV LSSLPPPPPV HHHHQYHHFP  240
ATSPSVAGSF PPGMMTFGGG GGAAESSSED LNHIHMYEQS NQAGGSKKRF RTKFSQEQKD  300
KMMEVAEKLG WRIQKHDEQE VQQLCSELGI RRQVFKVWMH NNKQAMKKKQ L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-27ZF-HD family protein