PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0004621.1_g000012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 98aa    MW: 10840 Da    PI: 8.3772
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0004621.1_g000012.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer108.15e-342884360
                ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                               +vrY eC+kNhAa++Gg+avDGC+Efm+s g+egta+al+CaACgCHRnFHRreve+e
  Rmu_sc0004621.1_g000012.1 28 TVRYGECQKNHAANIGGYAVDGCREFMAS-GQEGTAEALTCAACGCHRNFHRREVETE 84
                               79**************************9.999*********************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    
MKKQQVVVRR DGSSRRSSSS TSSSMVRTVR YGECQKNHAA NIGGYAVDGC REFMASGQEG  60
TAEALTCAAC GCHRNFHRRE VETEVVCEYT PPNNSYQQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-38ZF-HD family protein