PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rmu_sc0002592.1_g000013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family ZF-HD
Protein Properties Length: 339aa    MW: 36624.8 Da    PI: 7.3241
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rmu_sc0002592.1_g000013.1genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.36.9e-32103160260
                ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                ++vrY+eClkNhAa++Gg+++DGCgEfmp  geegt +alkCaAC+CHRnFHR+ev+ e
  Rmu_sc0002592.1_g000013.1 103 SNVRYRECLKNHAANIGGNVFDGCGEFMPC-GEEGTLEALKCAACDCHRNFHRKEVDGE 160
                                689**************************9.999*********************9865 PP

Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    
MRTSGSALSY GATHLTKESS GGGEKRRLGN IHNGTPTALS AFTATHQTLD HHHPLQPHHV  60
QPVPLTTRDL DPDRVGSTAV APSGGVLSGG PKSKTPSSTS TTSNVRYREC LKNHAANIGG  120
NVFDGCGEFM PCGEEGTLEA LKCAACDCHR NFHRKEVDGE TTPFGPGSRS RSIMLSPLQL  180
PPPLPSPSSA LHHHRHQKFS IVQPMSVAFG GGGGGTESSS EDLNVFDNGD GVGGGVVPPF  240
SLSKKRFRTK FTPEQKVRMV EFAERVGWRI QKQDEEDVEK FCDEVGVKRQ VLRVWMHNNK  300
NTVKKMQHDH DITTTTSQLA LENVEAHEEP GQEGGGTDT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.11e-65ZF-HD family protein