PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RcHm_v2.0_Chr4g0441941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family YABBY
Protein Properties Length: 208aa    MW: 23259.1 Da    PI: 7.4063
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RcHm_v2.0_Chr4g0441941genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY26.22.4e-08729325
                   YABBY  3 vfssseqvCyvqCnfCntilavs 25
                            +f+ +eq+CyvqC+fC til+v 
  RcHm_v2.0_Chr4g0441941  7 LFDLPEQICYVQCGFCATILLVI 29
                            6899****************995 PP

2YABBY150.51.6e-464618720159
                   YABBY  20 tilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekeesastsvssekl. 101
                              +l+vsvP +sl+++vtvrCGhC+ llsvn+ kas    +lla+     +++ +e  +e  vee +  ++    +  s s+++++  
  RcHm_v2.0_Chr4g0441941  46 PVLVVSVPCSSLSRLVTVRCGHCSCLLSVNMLKASflpfHLLASLG---QNVDQEKDQEICVEEVEEVKYPGLGDMRSPSMAVSNNs 129
                             69*****************************999865555555544...34444444444333333222222222222222222220 PP

                   YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159
                             +++e  +++  + v++PPekrqr+Psaynrfikeeiqr+ka+nP+++h+eafs+aakn
  RcHm_v2.0_Chr4g0441941 130 ENEEYTNITLNHIVNKPPEKRQRAPSAYNRFIKEEIQRLKAENPSMTHKEAFSTAAKN 187
                             34455566666679*******************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    
MTTLNGLFDL PEQICYVQCG FCATILLVIL NIIARLLLYI LFALQPVLVV SVPCSSLSRL  60
VTVRCGHCSC LLSVNMLKAS FLPFHLLASL GQNVDQEKDQ EICVEEVEEV KYPGLGDMRS  120
PSMAVSNNSE NEEYTNITLN HIVNKPPEKR QRAPSAYNRF IKEEIQRLKA ENPSMTHKEA  180
FSTAAKNVGV PFSLLNHLTI LISKHRNS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.18e-50YABBY family protein