PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RcHm_v2.0_Chr4g0437891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family YABBY
Protein Properties Length: 184aa    MW: 20390.1 Da    PI: 8.7615
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RcHm_v2.0_Chr4g0437891genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY171.65.1e-5391671165
                   YABBY   1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas..qllaaeshldeslkeelleelkveeenlksn 85 
                             +d+++ se++Cyv+CnfCnt+lav +P + ++ +vtv+CGhC++l  ++ + ++  ql++a ++ + +       +l + ++++++ 
  RcHm_v2.0_Chr4g0437891   9 MDLVQPSEHLCYVRCNFCNTVLAVGLPCKRMMDTVTVKCGHCSNLSFLTTRPNNpiQLQPAPHQCQIND---YPTTL-TLHQSFSTD 91 
                             578999**************************************9888877766546777766633333...33333.334556666 PP

                   YABBY  86 vekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPk 165
                               + +s+s+s ++    + e+ ++p++p v +PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknWa +P+
  RcHm_v2.0_Chr4g0437891  92 SRRGHSSSSSSPT----SLESPSSPKAPFVCKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYPT 167
                             6666666666555....335677899999*************************************************95 PP

Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    
MNLEDKVTMD LVQPSEHLCY VRCNFCNTVL AVGLPCKRMM DTVTVKCGHC SNLSFLTTRP  60
NNPIQLQPAP HQCQINDYPT TLTLHQSFST DSRRGHSSSS SSPTSLESPS SPKAPFVCKP  120
PEKKHRLPSA YNRFMKEEIQ RIKAANPEIP HREAFSAAAK NWARYPTPSA TAASDSGSSN  180
KLNE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.12e-57YABBY family protein