PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RcHm_v2.0_Chr2g0093041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family HRT-like
Protein Properties Length: 464aa    MW: 51693.1 Da    PI: 10.0309
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RcHm_v2.0_Chr2g0093041genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like60.92e-19266296131
                HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                             iCGv+ +dGs+C+++Pv+gRKRC+eHKGmRi
  RcHm_v2.0_Chr2g0093041 266 ICGVAVGDGSICRKEPVQGRKRCAEHKGMRI 296
                             8*****************************7 PP

2HRT-like47.53.1e-15335365131
                HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                             iCG++ +dGs+C+++Pv+gRKR +eH GmRi
  RcHm_v2.0_Chr2g0093041 335 ICGLAAGDGSICRTPPVQGRKRSAEHRGMRI 365
                             8*****************************7 PP

3HRT-like58.31.3e-18417447131
                HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                             iCG+il dGs+C+++P++gRKRC eHKG+Ri
  RcHm_v2.0_Chr2g0093041 417 ICGFILADGSPCRTEPIQGRKRCDEHKGRRI 447
                             8*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    
MVASDLTVAL QRLKREECKR TKHDPHFSKW KVLVGPCDWE DFSVGKEGAE RYRVHNLPRN  60
ESPGVYELGV AVLRSGLGRG IEADKIVPVY LGQADSVRTR LQQYGRTGAH LGKCCSVGIP  120
SERIRKGPGL FEQILARGYP IVYRWAPMGT KSEALKTESQ LLNTFDYAWN TSINGARRPD  180
DVLQKLKKTS SKPTRFTNIV QRLLPFRQKQ VGIRINSSKL VSTEDKFSDY ADRESRTLTA  240
QVFKFGRSQP RLVLDRSGIT QENTIICGVA VGDGSICRKE PVQGRKRCAE HKGMRITGLI  300
TVRISNSNFD SKCSVISNRE FVSDESGITQ ENTEICGLAA GDGSICRTPP VQGRKRSAEH  360
RGMRIKGSIT VRISDKNVDS KCSVLNNTEL DSHDASNVKY EPVQLPPVHV CESSTSICGF  420
ILADGSPCRT EPIQGRKRCD EHKGRRIQKC KSKSVKEEKV KICA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.17e-99HRT-like family protein