PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023906613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Quercus
Family HRT-like
Protein Properties Length: 557aa    MW: 61829 Da    PI: 9.6824
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023906613.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like42.98.1e-14275304231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CGv l+dGsvC+r+P + RKR +eH GmRi
  XP_023906613.1 275 CGVPLGDGSVCRRPPLERRKRRAEHRGMRI 304
                     *****************************7 PP

2HRT-like37.34.7e-12324347124
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCe 24 
                     iCGv l++Gs+C rqP+kgRKRC 
  XP_023906613.1 324 ICGVPLNNGSPCVRQPAKGRKRCD 347
                     8**********************6 PP

3HRT-like44.92e-14394423130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     iCGv l+ G  C+rqP++gR RCeeHK  +
  XP_023906613.1 394 ICGVELGSGAYCTRQPARGRVRCEEHKSLK 423
                     8**************************876 PP

4HRT-like32.11.9e-10459486128
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKG 28 
                     +CG++ +dGs C+r+ v+g+KRC++H G
  XP_023906613.1 459 TCGATCRDGSLCRRKLVEGNKRCWQHGG 486
                     7*************************65 PP

5HRT-like512.5e-16521550130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     +CG++  dGs C+rqPv+g+KRC++HKGm+
  XP_023906613.1 521 TCGATCHDGSLCRRQPVEGNKRCWQHKGMK 550
                     7****************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    
MIATASGDSL TTMLKREDCN RTKHDSDFSD WKVLVGPSDW EDHSLGKEGA ARYRVHNLPK  60
NSGPGIYELG IAVSQAGLGR EVGKLDPDRL VVVYLGQADN VRTRLQQYGR TGAHLGNSYA  120
NGCANDSKNV SLQKRPGLFN EILSRGYPIV FRWAPMESKR DAEKTEDKLL IRFDYAWNTH  180
SNGARRRDDI LQKLNKIDSG TTRYPNMVRK LLPFSQKQVG IRIKASKLPS PENKLNTYAD  240
LESYNFLSRV FKFGRSQPRL VLDRIGVIED NTSFCGVPLG DGSVCRRPPL ERRKRRAEHR  300
GMRINMSIPK VVAECPVSES FTPICGVPLN NGSPCVRQPA KGRKRCDDDV DLDSSCHDAL  360
SYNQNSSAMC KPGIVQPRVS LEKLVVSKKG YETICGVELG SGAYCTRQPA RGRVRCEEHK  420
SLKVNGLVSK LEAEDKSHVS GLGSKLSTYN DYKYGNSTTC GATCRDGSLC RRKLVEGNKR  480
CWQHGGISAG SSFSGFDSGI NSLTCSKLST YNDYKYGNST TCGATCHDGS LCRRQPVEGN  540
KRCWQHKGMK AGRSFYF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-96HRT-like family protein