PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023906612.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Quercus
Family HRT-like
Protein Properties Length: 620aa    MW: 68518.3 Da    PI: 9.4993
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023906612.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like573.3e-18275304231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CGv l+dGsvC r+P + RKRC+eHKGmRi
  XP_023906612.1 275 CGVSLGDGSVCWRPPLERRKRCAEHKGMRI 304
                     *****************************7 PP

2HRT-like58.51.1e-18364394131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv l++Gs+C+rqP+kgRKRC  HKGmRi
  XP_023906612.1 364 ICGVPLNNGSPCSRQPAKGRKRCDDHKGMRI 394
                     8*****************************7 PP

3HRT-like40.45e-13457483127
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHK 27 
                     iC v l+ G  C+rqP++gR RCeeHK
  XP_023906612.1 457 ICEVDLGSGAYCTRQPARGRVRCEEHK 483
                     8************************** PP

4HRT-like33.38.3e-11522551130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     +CG++ +dGs C+r+ v+g+KRC++H G R
  XP_023906612.1 522 TCGATCRDGSLCRRKLVEGNKRCWQHGGIR 551
                     7*************************9977 PP

5HRT-like52.67.7e-17584613130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     +CG++  dGs C+rqPv+g+KRC++HKGmR
  XP_023906612.1 584 TCGATCHDGSLCRRQPVEGNKRCWQHKGMR 613
                     7****************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    
MVATASSDSL TTRLKREDCN RTKHDSVFSN WKVLVGPSDW EDYSLGKEGA ARYRVHNLPK  60
SSGSGIYELG IAVSQTGLGR EVGKLDPDRL VVVYLGQADN VRTRLQQYGR TGAHLGNSYA  120
NGCANDSKNV SLQKRLGLFD ETLSRGYPIV FRWAPMESKR DAEKTEAQLL NRFDYAWNTS  180
FNGARRPDDI VQKLNKIASG TTRYSNIVRK LLPFSQKQVG IRIKASKLPS PENKLNTYAD  240
EESYNFLPRV FKFGRSQPRL VLDRIGVIED NTSFCGVSLG DGSVCWRPPL ERRKRCAEHK  300
GMRIHMSILK VVTEGKPTSI VGSDFSTVAD RKSGSDSAQN FSDGTTELQP VPVKCPVSES  360
VTPICGVPLN NGSPCSRQPA KGRKRCDDHK GMRICRFISE SVTEGKSQYD HDVDLDSSCH  420
DALSYNQNSS AMCKPGIVLQ PRVSSEKLVV SKGYGTICEV DLGSGAYCTR QPARGRVRCE  480
EHKWLKINGL VLKLEAEDKS HVSGLGSKLS TSNDYKYGNS TTCGATCRDG SLCRRKLVEG  540
NKRCWQHGGI RAGGSFSGFD SGINSLTCSK LSSYNDYKYG NSTTCGATCH DGSLCRRQPV  600
EGNKRCWQHK GMRAGRSFYF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-103HRT-like family protein