PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_026453295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Family HRT-like
Protein Properties Length: 471aa    MW: 52885.2 Da    PI: 9.5552
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_026453295.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like55.97.1e-18278308131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv l+dGsvC+ +Pv+gRKRCeeHKG+Ri
  XP_026453295.1 278 ICGVSLGDGSVCRVKPVRGRKRCEEHKGRRI 308
                     8*****************************7 PP

2HRT-like53.54e-17323353131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv+ledGs+C + Pv+gRKRCe HKGm+i
  XP_026453295.1 323 VCGVHLEDGSCCIEIPVQGRKRCELHKGMKI 353
                     7****************************97 PP

3HRT-like48.51.5e-15381409129
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGm 29 
                     iCGv+l+d svC++ Pv gRKRCe H Gm
  XP_026453295.1 381 ICGVLLSDASVCNARPVDGRKRCELHEGM 409
                     8***************************9 PP

4HRT-like36.48.6e-12444468125
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCee 25 
                     +CGv+l+dGs+C+  P+ gRKRCe 
  XP_026453295.1 444 TCGVLLSDGSICNVRPIGGRKRCER 468
                     7**********************95 PP

Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    
MGIKEDPTRF VRLKREECKR TKHDSAFSEW KVLIGPSDWE NYLLRKEGVE RYRNHNLPLT  60
CSCPGLYELG VASTRSNSGR HVRKLDQNGI IVVYLGQADN IRSRLQDYVR AGSHLDRGKS  120
TNNLNADSNF VYQRGPGLFK EIFSKGFPIV FRWASLENKK EAEKTETQLL RVFDYAWNTG  180
GNGARRPNDI LLKLDKINSS TSPFPNVTRK LHQWLLVLEQ PFIRKKSGIR IKSVSPVKSD  240
GSNDQTSVDS HSRVFKFGRT QPRLVFDKCD MNEEDAVICG VSLGDGSVCR VKPVRGRKRC  300
EEHKGRRIIG CVPESVKENK SVVCGVHLED GSCCIEIPVQ GRKRCELHKG MKISTSRSVQ  360
DKGSTVSKSD TILESEEHSI ICGVLLSDAS VCNARPVDGR KRCELHEGMN LRTSINVHEK  420
GSPVSNSDPI SDRKSENEEK CIITCGVLLS DGSICNVRPI GGRKRCERTK S
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.14e-92HRT-like family protein