PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_026447495.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Family HRT-like
Protein Properties Length: 525aa    MW: 58590.9 Da    PI: 9.8447
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_026447495.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like55.78.5e-18278308131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv l+dGsvC+ +Pv+gRKRCeeHKG+Ri
  XP_026447495.1 278 ICGVSLGDGSVCRVKPVRGRKRCEEHKGKRI 308
                     8*****************************7 PP

2HRT-like54.71.7e-17323353131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv+ledGs C + Pv+gRKRCe HKGm+i
  XP_026447495.1 323 VCGVNLEDGSRCIEIPVQGRKRCELHKGMKI 353
                     7****************************97 PP

3HRT-like521.2e-16382411130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     iCGv l+d svC++ P+ gRKRCe HKGm 
  XP_026447495.1 382 ICGVFLSDASVCSARPIDGRKRCELHKGMN 411
                     8****************************6 PP

4HRT-like51.41.8e-16445474130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     +CGv+l+dGs+C+  P+ gRKRC eHKG+R
  XP_026447495.1 445 TCGVLLSDGSICNVRPIGGRKRCGEHKGQR 474
                     7****************************9 PP

5HRT-like551.4e-17492522131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv l+dG vC+++PvkgRKRCe HKG+Ri
  XP_026447495.1 492 ICGVGLGDGYVCTKNPVKGRKRCEMHKGRRI 522
                     8*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    
MGIKDDPTRF VRLKREECKR TKHDSAFSDW KILIGPSDWE NYLLRKEGVE RYRNHNLPLT  60
CSCPGLYELG VASTRSNSGR DVRKLDQNGI IVVYLGQADN IRSRLQDYGR AGSHLDRGKS  120
TNNLNADSNF VYQRGPGLFK EIFSKGFPIV FRWASLENKK EAEKTETQLL RVFDYAWNTG  180
GNGARRPNDI LLKLDKINSS TSPYPNVTRK LQEWLLVLEQ PFIRKKSGIR IKSVSPVKSD  240
GSNDQTSEGS HPRVFKFGRT RPRLVSDKCD MNEEDAVICG VSLGDGSVCR VKPVRGRKRC  300
EEHKGKRIIG CVPEAVKEDK SVVCGVNLED GSRCIEIPVQ GRKRCELHKG MKISTSRSVQ  360
EKGSTVSKSD TILEREEGHS IICGVFLSDA SVCSARPIDG RKRCELHKGM NVCTSINVHE  420
KGSPVSNSDP ISDRKSENEE KCIITCGVLL SDGSICNVRP IGGRKRCGEH KGQRANNVSI  480
SKSKIEEINS VICGVGLGDG YVCTKNPVKG RKRCEMHKGR RITPK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.14e-99HRT-like family protein