PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM89807.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 464aa    MW: 50712.4 Da    PI: 6.5069
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM89807.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.22.6e-061447336
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                ++ C+ ++++ + l+C+ ++  lC  C  + H+ 
  OWM89807.1 14 APPCDFCSDQAAVLYCRADSARLCLLCDHHVHSA 47
                689**************************99954 PP

2zf-B_box26.11.7e-0857101341
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                  ++C+++ +++++  C++++ llC+dC    H +      H++ p
  OWM89807.1  57 SQICDNCASEPASVRCRTDNLLLCQDCDWDAHGScststpHDRAP 101
                 579*************************99994488888887766 PP

3CCT65.41.7e-22416459144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R +a+lRYkeK+ktR+++K+irYesRKa+A++R+RvKGrFvk++
  OWM89807.1 416 RGNAMLRYKEKKKTRRYDKHIRYESRKARADTRKRVKGRFVKST 459
                 7789**************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    
MAIPNSAAGD GRDAPPCDFC SDQAAVLYCR ADSARLCLLC DHHVHSANLL SRKHLRSQIC  60
DNCASEPASV RCRTDNLLLC QDCDWDAHGS CSTSTPHDRA PIDAFSGVPS AIELASLWEL  120
DLEEEKRPSQ GAIEGQLLED VLLPFGFQEL IVPSENVVVG YHNGSNFGEI VSVMKKQNPS  180
CGKHRQVMQK QLAELSRRGL VDGGVGDTLV PGTPAGTDTW RENVEGMNGA DAVQQLPEPT  240
VAVAVVTSAS QRDQRDSGGD DRDRARDGNP NHRAQTPQIW DFNLGQSRGQ NEPDHFGYGK  300
NEEGFMIMSY GELMQESSSA KVFGNAFQMN CHVAPEDMAF FNDNLNSLAL SQGAATSESN  360
NLPVPRASSV SSLEKAKGPS GSRYYQLAGQ TTTVKNDSGR TAAKTKSDME LLAQNRGNAM  420
LRYKEKKKTR RYDKHIRYES RKARADTRKR VKGRFVKSTE ASDG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.13e-94CO-like family protein