PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM81535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 429aa    MW: 45991.2 Da    PI: 4.9843
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM81535.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box231.6e-074790542
    zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42
                 C+++++++++  C + ++ lC++C   +H g       H+++++
  OWM81535.1 47 LCERCNSQPAIVRCAEEKVSLCHNCDWIGH-GastsgsaHKRQSI 90
                7*****************************.55888899988765 PP

2CCT62.91e-21372415144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R  a++RYkeK+ktRkFeK++rY+sRKa+A+ R+RvKGrFvk+ 
  OWM81535.1 372 RSDAVMRYKEKKKTRKFEKRVRYASRKARADVRKRVKGRFVKAG 415
                 889**************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    
MGYMCDFCGE QRSMVYCRSD VACLCLSCDR NVHSANALSK RHFRTLLCER CNSQPAIVRC  60
AEEKVSLCHN CDWIGHGAST SGSAHKRQSI DSYSGCPSAA ELSSIWSSVL EVPSVVDTTC  120
EEELGLMSIS ENNLKASSWV GSERNMSLGG GVVEAEKTNV LTGSSSSLPE LKSTSQSLSQ  180
QTTTPMNAPS SKASDGTHTF GAASLSILVC YPTAKGPPLF EDDSLYEDFN MDEVDLNLEN  240
YEELFGVTLN SSEDLLENGG IDSLFSAKEL SAADSNGQGA VLAEGSSAQL VNPQPACSAA  300
SADSMMSSKT DSILCFTSRQ QAHANLSFSG LNGESTGGDY QDCGASSMLL MGEPSWCPPG  360
SAESSLPSAA GRSDAVMRYK EKKKTRKFEK RVRYASRKAR ADVRKRVKGR FVKAGDAYDY  420
DPLSPTRSF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.21e-106CO-like family protein