PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM76249.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 477aa    MW: 51801 Da    PI: 7.0783
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM76249.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.55e-071355541
    zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 C+ ++e  + l+C+ ++  lC  C ++ H+       Ht+++
  OWM76249.1 13 PCDFCSERAAVLYCRADSAKLCLFCDQHVHSAnllsrkHTRSQ 55
                6******99*********************6688888998765 PP

2zf-B_box21.45.1e-075498341
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 ++C++++ ++++  C +++  lC++C    H +      H+++p
  OWM76249.1 54 SQICDNCSAEPVSVRCSTDNLVLCHECDWDAHGScpvsasHDRTP 98
                689*************************99995488888888877 PP

3CCT652.2e-22429472144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R+ a+lRYkeK+ktR+++K+irYesRKa+A++R+RvKGrFvk++
  OWM76249.1 429 RDSAMLRYKEKKKTRRYDKHIRYESRKARADTRKRVKGRFVKAT 472
                 899**************************************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    
MVNPKSRTGV SAPCDFCSER AAVLYCRADS AKLCLFCDQH VHSANLLSRK HTRSQICDNC  60
SAEPVSVRCS TDNLVLCHEC DWDAHGSCPV SASHDRTPVE GFSGCPSAPE LAALWGLDLE  120
KKKPSPTGQM NPLMPNVVYG FQDSIVPTNN PLIFSNMSCG EILNASKRQD PGTGRSKRVI  180
HEQLLELLKQ DVVSGAGGGN DNGEGGGGEN MVPGTPNINA WEGNIDGSGA GVFGDGASNT  240
AVGTVPSQML QQQGIFTSLL MLPGPMDLKE STEGNTQWES NPSRTAQIWD FNLGQLRDHE  300
EPGLLEVGYV TNDTGFTIKS YGELLKESSF TSTKVLEDMY QFNCSLAHED VTSFIQNKHP  360
AASQGPATSE SNNLPIPRTS PNAIPVKPKG FTVSTDNNQF ADQPVLVRSD SGRTTAARRA  420
NVDLLAQHRD SAMLRYKEKK KTRRYDKHIR YESRKARADT RKRVKGRFVK ATAAPDG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.11e-105CO-like family protein