PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM75774.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 430aa    MW: 47841.3 Da    PI: 6.0114
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM75774.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.41.7e-091659340
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                +r C+ + +k+++++C  ++ +lC++C  + H+       H++v
  OWM75774.1 16 ARACDSCIQKRARWYCAADDAFLCQSCDASVHSAnplarrHERV 59
                578*****************************657888888876 PP

2CCT69.11.1e-23374416143
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                 Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+
  OWM75774.1 374 REAKVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR 416
                 9****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    
MISHKNAASA VSGKTARACD SCIQKRARWY CAADDAFLCQ SCDASVHSAN PLARRHERVR  60
LKTASLRNLN EFPKENKDSA PSWHRGFTKK ARTPRHGKAV LSVRNPIPLV PEFGGDETSN  120
EENEEQLLYR VPAYDPFASE LCSSKETEIV APFDFNETKG VPVRYGTGAE RMHGFLPSDT  180
DLAEFAADVE SLLGKGLENE SFGMEGLGLM DCDKERENSQ DCSFGSEKLV KTEDEGVLAP  240
DVGQDNQVDA EIDISKETFE LNFDDYCSPT TCGEEEDEKV AEPEAHANVE NPVKDAAKKR  300
RKIFLKLDYE SVLESWSSQG SPWTSGDRPD LNSDDYWPDC LGLYGGEVHN HHGELVGGGG  360
GYGGHMGVGS TAGREAKVSR YREKRRTRLF SKKIRYEVRK LNAEKRPRMK GRFVKRVPFT  420
GPTSFPLLSK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298302KKRRK
2385401RRTRLFSKKIRYEVRKL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-95CO-like family protein